PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G048700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 382aa    MW: 41061.7 Da    PI: 7.9762
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G048700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51111391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+
  Brast03G048700.1.p  11 VPPGFRFHPTEEELLNYYLRKKVASQQIDL-DVIRDVDLNKLEPWDIQErcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 100
                         69****************************.9***************963444443456******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk++++   + +g++ktLvfykgrap+g k+dW+mheyrl
  Brast03G048700.1.p 101 DKAIYN-AVARIGMRKTLVFYKGRAPHGLKSDWIMHEYRL 139
                         ******.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-567178IPR003441NAC domain
PROSITE profilePS5100555.85811178IPR003441NAC domain
PfamPF023651.2E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQQIDL DVIRDVDLNK LEPWDIQERC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVAR IGMRKTLVFY  120
KGRAPHGLKS DWIMHEYRLL DADDSASAAV VTASSASDAA AGQQQGEDGW VVCRVFKKKH  180
HHKDSTSSGS GKKAAAAALR RSSSSPLYSS GDDAALDQIL HYMGRSSSAC KQEHGSPRPG  240
PAQTQAQAQA RPASRYLRPI ETALAAGHGF MKLPPLESPS AAAPPSAAAP APETTMDWAM  300
MDRLVASHLN GQLHDESSAV DDDRRLCSSS AFDAGAGAGD DDGGLAFYSA AAATRLLGAV  360
DDDLWSFARS AERLGHGHAS Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-471118115171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934290.0JQ693429.1 Brachypodium distachyon SWN8 (SWN8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289809.10.0uncharacterized protein LOC100821210
SwissprotQ84WP61e-113NAC43_ARATH; NAC domain-containing protein 43
TrEMBLI1I0H70.0I1I0H7_BRADI; SWN8
STRINGBRADI3G13727.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.14e-83NAC family protein